We made an all acoustic, stripped down version of #Cardigan yesterday. Have a listen! https://t.co/sUZyj1WLRp— Aaron Dessner (@aaron_dessner) July 30, 2020
i think it's just an alternate mix, not the demo. the piano & vocal take sounds the same as the album version, so the only new addition to the mix is the acoustic guitar.
i like the album version's percussion, it adds to the ways it reminds me of tori
― ufo, Friday, 31 July 2020 06:13 (three years ago) link
ah ok. I googled it while listening and nme.com calls it a demo. I've been lied to.
― a morley steve vai bad horsie what? (Sufjan Grafton), Friday, 31 July 2020 06:35 (three years ago) link
i've heard "cardigan" on the radio several times now and to my surprise it never sounded out of place
― dyl, Sunday, 2 August 2020 22:48 (three years ago) link
A "remix/mashup" of Mirrorball and This Is Me Trying, tagged as #Shoegaze. Probably closer to Noise Pop due to the blown-out nature of the mix. Pretty cool.
https://soundcloud.com/stpaulattheendoftheworld/mirror-trying-remix-mashup-of-taylor-swift-mirrorball-this-is-me-trying
― Skrot Montague, Saturday, 8 August 2020 00:18 (three years ago) link
This album is so precisely my shit. Just killer track after killer track. Giving me a lot of mid-90s lo-fi indie vibes, Scrawl in particular. I don't think she's ever written better melodies or let herself just consistently stretch out like this. And when she has in the past the lyrics have always felt a bit cloying, like overcompensating or showy, and now its just so goddamn seamless. This is now up in competition with any of the classic singer-songwriter albums from the 70s or whatever. I absolutely didn't expect we could ever have chart-topping albums like this ever again.
― Hakim Bae's TMZ (s.clover), Friday, 14 August 2020 01:48 (three years ago) link
even the "bad" ones have grown on me
― it's a spicy dinner we're having (Sufjan Grafton), Friday, 14 August 2020 02:08 (three years ago) link
also how tf did the whole conversation about "cardigan" revolve around ldr and not like early fiona apple? (and there's a lot of half-quotes of "wildest dreams" too)
― Hakim Bae's TMZ (s.clover), Friday, 14 August 2020 02:43 (three years ago) link
the other comparison that came up apart from ldr wrt "cardigan" was tori amos which i agree with far more
― ufo, Friday, 14 August 2020 03:06 (three years ago) link
um, Scrawl vibes?! guess I will listen to this after all
― geoffreyess, Friday, 14 August 2020 03:16 (three years ago) link
hmmm but scrawl were good
― unpaid intern at the darvo institute (Simon H.), Friday, 14 August 2020 03:18 (three years ago) link
I played this a lot those first few days, but haven’t been compelled to revisit it. I guess each album of hers (since Red) has had less staying power for me than the one preceding it.
― Get your filthy hands off my asp (morrisp), Friday, 14 August 2020 03:58 (three years ago) link
I very much enjoyed relistening to this tonight although yeah you could cut 3-4 songs easy
― sleeve, Friday, 14 August 2020 05:30 (three years ago) link
I resequenced the album and it made me love it a lot more
― winters (josh), Friday, 14 August 2020 06:22 (three years ago) link
there's a natural flow to the songs on this album that isn't the official track listing, and it serves to highlight the songs that make up the album much more
― winters (josh), Friday, 14 August 2020 06:23 (three years ago) link
without having to cut any songs if you don't want to -- it's definitely a slow burn of an album
josh post the sequence
― unpaid intern at the darvo institute (Simon H.), Friday, 14 August 2020 06:47 (three years ago) link
here's my sequence! it sounds like a proper adventure through the wilderness with peaks and valleys along the way -- starts out slow and sunny, slowly shifts into sepia and somber, moves through those tones, then eventually finds some clearing at the end.
it may be helpful to view this sequencing in the LP format -- Side A: 1-4; Side B: 5-8; Side C: 9-12; Side D: 13-16
1. epiphany2. mirrorball3. august4. invisible string5. betty6. the last great american dynasty7. illicit affairs8. cardigan9. hoax10. seven11. mad woman12. exile (ft. Bon Iver)13. this is me trying14. my tears ricochet15. peace16. the 1
― winters (josh), Friday, 14 August 2020 13:06 (three years ago) link
i guess i shouldn't be surprised that ppl here are driven to resequence the best-sequenced taylor swift record since fearless but... whet?????? "the 1" last???? no way
― mellon collie and the infinite bradness (BradNelson), Friday, 14 August 2020 13:16 (three years ago) link
i mean not to knock the adventure you've created josh, it looks like a fun listen!
― mellon collie and the infinite bradness (BradNelson), Friday, 14 August 2020 13:19 (three years ago) link
yeah there's nothing wrong with the sequence at all and i think her sequencing has usually been kinda dubious at best.
― ufo, Friday, 14 August 2020 13:21 (three years ago) link
ha no big! we're all just having fun here
― winters (josh), Friday, 14 August 2020 13:32 (three years ago) link
guess it's just indicative of how I listen to music
― winters (josh), Friday, 14 August 2020 13:35 (three years ago) link
"the 1" last????
You should hear my "Wish" resequence that starts with "End" and ends with "Open." Totally changes your perspective, makes you think! No wonder Robert Smith is struggling with the remaster.
― Josh in Chicago, Friday, 14 August 2020 13:35 (three years ago) link
(I can totally imagine resequencing "Folklore." Tbh, I doubt there are many 70 minute, 17-song albums that couldn't be successfully shuffled.)
― Josh in Chicago, Friday, 14 August 2020 13:37 (three years ago) link
I should try a resequence, like josh's, because my attention runs out of steam by the last three songs, which I'll probably love should I be more receptive to listening to them carefully
― Joey Corona (Euler), Friday, 14 August 2020 13:39 (three years ago) link
Whoever mentioned Scrawl in this thread, thanks! I don’t hear this album at all but I discovered a band I’d never heard of and immediately like
― a hoy hoy, Friday, 14 August 2020 20:59 (three years ago) link
awesome, Scrawl are great
― sleeve, Friday, 14 August 2020 21:55 (three years ago) link
travel on rider is dope
― Blues Guitar Solo Heatmap (Free Download) (upper mississippi sh@kedown), Friday, 14 August 2020 22:01 (three years ago) link
bonus track "the lakes" is now available to hear: https://www.youtube.com/watch?v=tOHcAc3r2kw
― monotony, Tuesday, 18 August 2020 07:39 (three years ago) link
not bad but the album is definitely better without it
― ufo, Tuesday, 18 August 2020 08:42 (three years ago) link
I woke up with "Mirrorball" and "The 1" in my head, a lovely way to wake up.
― TikTok to the (Alfred, Lord Sotosyn), Tuesday, 18 August 2020 10:07 (three years ago) link
"the lakes" is fine but a song that references twitter would strike a false note on the album
― mellon collie and the infinite bradness (BradNelson), Tuesday, 18 August 2020 14:54 (three years ago) link
No song that alludes to Wordsworth and Coleridge can't be a bad song.
― TikTok to the (Alfred, Lord Sotosyn), Tuesday, 18 August 2020 14:55 (three years ago) link
uh lol can be a bad song
i want auroras and sad prosei want to watch wisteria grow right over my bare feetbecause i haven't moved in years
― mellon collie and the infinite bradness (BradNelson), Tuesday, 18 August 2020 15:12 (three years ago) link
actually when i heard "the lakes" last month i immediately thought of it as a decoder for the rest of folklore, it sets the intentions
― mellon collie and the infinite bradness (BradNelson), Tuesday, 18 August 2020 15:14 (three years ago) link
The album's now split into EP-size chunks ("the escapism chapter," "the sleepless nights chapter")?
― “Pizza House!” (morrisp), Tuesday, 25 August 2020 03:41 (three years ago) link
This is definitely the 2020 album on top of 'recently' in spotify that I just gravitate towards and end up listening to even when I've entered with different intentions
― abcfsk, Tuesday, 25 August 2020 07:23 (three years ago) link
It goes well with anything — brunch, cocktails, late nights. The perfect 2020 lifestyle accessory album, which I mean in a good way.
― a man often referred to in the news media as the Duke of Saxony (tipsy mothra), Tuesday, 25 August 2020 16:02 (three years ago) link
No song that alludes to Wordsworth and Coleridge can't be a bad song.uh lol can be a bad song
Agree that Genesis's "The Colony of Slippermen", Rush's "Xanadu", and Iron Maiden's "Rime of the Ancient Mariner" are classic.
― The nexus of the crisis and the origin of storms (Sund4r), Tuesday, 25 August 2020 16:16 (three years ago) link
otm
― TikTok to the (Alfred, Lord Sotosyn), Tuesday, 25 August 2020 16:39 (three years ago) link
\m/
― The nexus of the crisis and the origin of storms (Sund4r), Tuesday, 25 August 2020 16:49 (three years ago) link
I Designed A Taylor Swift Theme Park w/60+ Attractions!
― Josh in Chicago, Thursday, 27 August 2020 19:30 (three years ago) link
https://www.youtube.com/watch?v=pno5g88MONo
(That was a C&P error, I didn't design this, lol)
― Josh in Chicago, Thursday, 27 August 2020 19:31 (three years ago) link
taking stannery to a whole new level..... I admire his Virgo mastermind energy
― winters (josh), Monday, 31 August 2020 04:25 (three years ago) link
this is the best movie of 2020 — his love of her music is so sweet and sincere
― winters (josh), Monday, 31 August 2020 04:40 (three years ago) link
For anyone who care, here is how those aforementioned "EPs" break down:
folklore: the saltbox house chapterlast great american dynastyaugustthe 1seven peacebetty
folklore: the sleepless nights chapterexile (feat. Bon Iver)hoaxmy tears ricochetillicit affairsthis is me tryingmad woman
folklore: the escapism chapterthe lakessevenepiphanycardiganmirrorballexile (feat. Bon Iver)
It's weird that "Exile" appears twice? Or maybe not weird, I'm sure there's some logic behind it.
― “Pizza House!” (morrisp), Wednesday, 2 September 2020 19:27 (three years ago) link
Probably wanted to make it an even 6 for each EP, but only had 17 songs to work with. Also throwing some more streaming change at her buddy Mr. Iver.
― soaring skrrrtpeggios (jon /via/ chi 2.0), Wednesday, 2 September 2020 19:29 (three years ago) link
Good song to repeat, IMO
― “Pizza House!” (morrisp), Wednesday, 2 September 2020 19:32 (three years ago) link